PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco025795.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family B3
Protein Properties Length: 273aa    MW: 31439 Da    PI: 9.8147
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco025795.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B343.27e-1420872999
                 -..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
           B3 29 kkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99
                  k ++ t tl ++ g+ W ++l+ +  +g +++ +GW+eF +a++L +g fvvF+++g++ f  +vkvf++
  Aco025795.1 20 AKGRGETATLFSPLGKFWHITLQRDVDDG-MYFDSGWREFSQAHNLVAGCFVVFRYEGNMVF--KVKVFDA 87
                 35577899**************6555554.679*****************************..9999997 PP

2B365.39.5e-21180263390
                  EE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE CS
           B3   3 kvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsef 90 
                   + +++++++  r+++pk+f+++hg+    + ++tl+d++ r W vkl  +++++++ ++kGW +F   n+L++gD ++F+l++++  
  Aco025795.1 180 EKIIRPYNFSCFRMSVPKEFCASHGLLR--KEEMTLKDPKQRLWPVKL--WQGKRQIRFSKGWMDFSMGNKLEDGDKCIFQLVSSEVM 263
                  345699******************9884..458***************..*******************************9875444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5086312.379188IPR003340B3 DNA binding domain
SMARTSM010191.2E-6488IPR003340B3 DNA binding domain
SuperFamilySSF1019361.24E-18890IPR015300DNA-binding pseudobarrel domain
PfamPF023621.0E-101187IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.106.5E-181190IPR015300DNA-binding pseudobarrel domain
CDDcd100174.72E-131886No hitNo description
Gene3DG3DSA:2.40.330.101.7E-25175269IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.34E-24175269IPR015300DNA-binding pseudobarrel domain
CDDcd100171.26E-20177267No hitNo description
PROSITE profilePS5086313.296178271IPR003340B3 DNA binding domain
SMARTSM010192.5E-15179271IPR003340B3 DNA binding domain
PfamPF023629.5E-18180263IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 273 aa     Download sequence    Send to blast
MPHFYHLLQP IPNPIAQLLA KGRGETATLF SPLGKFWHIT LQRDVDDGMY FDSGWREFSQ  60
AHNLVAGCFV VFRYEGNMVF KVKVFDASGC RKQYDKIAHG IVEEISVDSK DEEPDEVLII  120
DDQQNLSTCS RKRRKSARLN SKSSAQQQGN GEPRTPPVFR SKNKSVEKSN NSGDYPPHFE  180
KIIRPYNFSC FRMSVPKEFC ASHGLLRKEE MTLKDPKQRL WPVKLWQGKR QIRFSKGWMD  240
FSMGNKLEDG DKCIFQLVSS EVMQVIIQKR RA*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42535187
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66980.15e-19B3 family protein